SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291298780|ref|YP_003510058.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291298780|ref|YP_003510058.1|
Domain Number 1 Region: 131-403
Classification Level Classification E-value
Superfamily Subtilisin-like 5.11e-74
Family Subtilases 0.00000529
Further Details:      
 
Domain Number 2 Region: 519-600
Classification Level Classification E-value
Superfamily PKD domain 2.88e-18
Family PKD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 49-116
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000289
Family Subtilase propeptides/inhibitors 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|291298780|ref|YP_003510058.1|
Domain Number - Region: 436-538
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00589
Family Leukotriene A4 hydrolase N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291298780|ref|YP_003510058.1|
Sequence length 601
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Stackebrandtia nassauensis DSM 44728]
Sequence
MRPLSARRFLAAAGAIALTTTTVLLAGSSAAHADESTILNATGDHVVDGRYIVVFNDSDV
SAKAKSVKSKAGDLADAYGGTVDHTYHATIRGFATTMDEADAKRLAAEPDVDYVEAVHKV
SVSDDQMNPPSWGLDRVDQNALPLDQKYSYPASAGQGTTIYILDTGTRLTHSTFGGRAKS
GYDFIDNDADASDCHGHGTHVAGTTAGSEYGVAKKANVVAVRVLNCSGSGTSDQIAKGID
WVTANASGPSVANMSLGGSGSDATMENAVQRSIDAGIQYSLAAGNNNGNACNTTPARLPA
AVTVGATTRTDSRDTAYSNYGSCLDLFAPGSGITSSSNNGDTASQSMSGTSMAAPHVAGA
MALYLAENPTATPQQVRDAIVDNGTKDKVTSPGSGSPNVLLYTGFITGDPPADNDFDIAA
DPGEATVDPGQSTTTKVSTTVTKGQAQAVTLSAKGLPSGAEASFDPASINSGESSTLTIS
TSASTPAGTYSVTITGTGADATRTAGFSLTVGDDGGDNKKPVASFTEICFGQWWSFCFFD
ANASSDSDGTVEEYSWEYGDGSTGTGSFASHAYPGPGTYTVTLTVTDDKGATGSISKTIT
L
Download sequence
Identical sequences D3PU19
WP_013016536.1.89426 gi|291298780|ref|YP_003510058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]