SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291299318|ref|YP_003510596.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291299318|ref|YP_003510596.1|
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-33
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 503-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291299318|ref|YP_003510596.1|
Sequence length 584
Comment serine/threonine protein kinase with PASTA sensor(s) [Stackebrandtia nassauensis DSM 44728]
Sequence
MYPGLSLGDRYTLEDLIGTSTGGSVWTGHDTVLDRPVRIKVLGIALSAEESNRARFRQST
LEVTTLQVPGVIDVFDCVEHFDDEQILECQIAERVDGIPLSRILNERSLGTEGTLSLVAT
AAWVLNEAHEAGARHLNLKPTNLIVTPDGSVTITDFAYLPTAPTHPYAAPEQRRGESAGI
PADVYSLGAIAYECVTGGPPTSDATLPDDTAPAIAAFIGRALSPTPAHRFGSAAILATEC
EQILHTSDVLDALLARSEPETESEAAAPEPVVEPEPKPEPLAATAKLPKRTALASAVEPP
PEPDPEPLVAAVPEPVVEPDPEPEPLVAAEGLRPWDVEPEPGPPPVTVTMEWRDPKPRPI
DPEPELLDPDEDPRLRDPKPRVRESAVPSHSHARKAKPRRKRLVLLAVVALAVVAATALT
VTTLLPQSAATSAADDYDPGTDDSTESTTLSPSESKEDHDRGKSDDPTSDDFTGTSSSSS
DKPSSPSPTKSSSSDDSPDPPQKVKVPNVVGDDKAAAISELKDADLQYNVIKSGEGDFEC
PIFDQSPDAGTSVVKGTTVDIELKLADNAEGCDDGGDEEPATKP
Download sequence
Identical sequences D3PYD6
WP_013017074.1.89426 gi|291299318|ref|YP_003510596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]