SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291299741|ref|YP_003511019.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291299741|ref|YP_003511019.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.23e-44
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 462-521
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291299741|ref|YP_003511019.1|
Sequence length 535
Comment serine/threonine protein kinase with PASTA sensor(s) [Stackebrandtia nassauensis DSM 44728]
Sequence
MQSGTILGERYTLGEQIGAGASGSVWTGHDTIVDRPVTIKVLKPELAEDDTTRERFRRVA
LKVAGLAVRGIVDVYDCLEEPDPDGGFLVCHITERVEGRSLRDLLDEGGTLPYPEALDLV
SDAVLALHAAHREGVVHGNLKPENLIIGDGGKITIVDFGFLPPSPSPYTAPELNDDSPAA
DVYGLGAVLYECLTGQPPTADGDISPLLSDMYPADAAPIMKAMSPQPSHRYASVVAFADA
CLHTDPAHGDSREDGEAGPPSRSGPIAEAAAALVLELDLADRDTPDDTEPTAEEPSEEPD
EADDAPSEPEPEPAASGEATEPSEPEAEPEPEPEPEQPESATVKATAVVASAAPVDEADA
DDDAPEPVDEPAKPRRSLRTQALVIGLLIAVLTVAAAVMHFAVPSQPSGSPASPDPTTES
SKSSASESSSSATDVDRPPNSAEPAPTTSSPSPSASSPDGNTVQVPNVVDMRRESAETEL
SGKGFTVIVNNDGNGRWECRVHDQSPVGGENVPAGTTVTIYVRRVNSPEQCIDPS
Download sequence
Identical sequences D3Q259
gi|291299741|ref|YP_003511019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]