SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291300455|ref|YP_003511733.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291300455|ref|YP_003511733.1|
Domain Number 1 Region: 26-368
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.01e-28
Family Soluble quinoprotein glucose dehydrogenase 0.00078
Further Details:      
 
Domain Number 2 Region: 366-452
Classification Level Classification E-value
Superfamily PKD domain 1.7e-23
Family PKD domain 0.00098
Further Details:      
 
Domain Number 3 Region: 696-819
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000131
Family Xylanase/endoglucanase 11/12 0.06
Further Details:      
 
Weak hits

Sequence:  gi|291300455|ref|YP_003511733.1|
Domain Number - Region: 848-986
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00095
Family Xylanase/endoglucanase 11/12 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291300455|ref|YP_003511733.1|
Sequence length 1029
Comment PKD domain-containing protein [Stackebrandtia nassauensis DSM 44728]
Sequence
MFKRIAFAIVILLTSATLTASTATAAPPADFDKTLISDGLNVPTAFRFASGGRILVAEKD
GAIRLIVNGVLRADPMITLSTAGADERGLLGLELDPAFDTNGYVYVGYTHTDNRNRLSRF
TATGSTIDPGSELVLLQSDQESNVFHHGGEIRFAPDGTLYWSLGMNTINVNSEQLGNLHG
KIHRINPDGTIPGDNPFAGVPGAEPSIWAYGLRNPFRFDLIGSGPNAGRLLSGDVGGSAW
EEINLIERGANYGWPKAEGLCDGCPYAQPVHTYPHTAPPASAGSITSVEIYTGGQFGSQY
DNAVFFADYTLGFIKYLKMDDEFRSVISVNDFDTAAGTPVQLTTGPDGALYQLNIYPGEL
YRIAPSGGNRAPEAKAAASPDNGLAPLRVRFSSAGSDDPDNDPISYRWDFGDGTTSTRAN
PSHTFFRNGKYQVKLTVSDGTKTDTATVPVQVGNRRPSATITAPADGFKYDAGDTISFAG
TGTDPEDGRLGPASMSWTVMFHHADHVHPFLGPVDGVASGEFTIPRAPDNLANTWYRIHL
KVTDSGGLTRSTYVDVKPNLVTLTVKTGTPGLSFTVDGIPHNGTLTETAVVGVERTLDVP
PLQYANDTRYQFASWSDGGDAAHTIVTPERDTVYTVDFTELPRPPDPWVETNVGARTQDG
WASYKDGEFTVNGSGWDIWDTTDEFHYANRPLSGDGRITARLTSQTDTDDWAKAGVMIKE
STQAGARYAAVAVTPDNGVRMQANFNEDDGGFAYQPGNAWLRLTRSGDTFTAETSDDGTN
WTRIGTTTLTMAKDVTIGLFSTAHDNTEFSKAVFDSVDVSGVPGPVPEPWTCGDVGDPRL
PGSAAHENGTFTITGAGDDIWATSDQFHYCHRQLDGDGRITARVTGQADTDDWAKTGVMM
KQSTQAGSPYVAAFVTPEHGVRTQTGFDTDTAGTQTGTPAWVRLERVGDTVTAYESPDGQ
QWTAIATATLSGPVTVGLFVTSHNGSVPNTSTLDSVDVDGPAEVEASLHNGMTSGSREDQ
GCGPLIFGP
Download sequence
Identical sequences D3Q9F8
gi|291300455|ref|YP_003511733.1| WP_013018211.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]