SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291300481|ref|YP_003511759.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291300481|ref|YP_003511759.1|
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.31e-23
Family DNA-binding N-terminal domain of transcription activators 0.0022
Further Details:      
 
Domain Number 2 Region: 123-271
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000016
Family Multidrug-binding domain of transcription activator BmrR 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291300481|ref|YP_003511759.1|
Sequence length 282
Comment MerR family transcriptional regulator [Stackebrandtia nassauensis DSM 44728]
Sequence
MFTIGDFARHGRVSVRMLRHYDAIGLLSPAHVDRSTGYRYYRAEQLSRLNRLVALKDLGF
TLRQVGSILDEDITVAELRAMLRLRRTELEETIATARSGLLQVEARLHSIEKEDSMPDED
IIVKKLPAVDLAELSAPADSFSPHHIGPVVDGLFDQLRARLAAAGVSATGPDTVYFETPD
QLGEQIIVHAGLPVATGTAAEDFDVTTLPPVETAATVLFPGLGNGFLAISQQLVRWVDTH
GYRFDGLARQISFGSSTDTAEQVAELQAPIVRTCGTPGGPAE
Download sequence
Identical sequences D3Q9I4
WP_013018237.1.89426 gi|291300481|ref|YP_003511759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]