SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291301676|ref|YP_003512954.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291301676|ref|YP_003512954.1|
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily Prim-pol domain 4.05e-24
Family Bifunctional DNA primase/polymerase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291301676|ref|YP_003512954.1|
Sequence length 304
Comment bifunctional DNA primase/polymerase [Stackebrandtia nassauensis DSM 44728]
Sequence
MDDGSRILATAELTRHALDYAARGWPVFMLGAGKVPLRLCRPCREADGDHDMEACPCLTC
HGFYAASTDPERVVAMVTGHPRGVLALRTGASSGVVVVDVDPRNDGTHTFVRLLADGVLP
ATVTANTGSRGLHLYYAHPGGTVKSGGNRLGPGVDVKADGAYVVLPPSTVNGKAYTWRPG
TDPTSLELSPIGHKLAELLAPAEPSAPVFRPAPMVSASASAFAAPSNARGRLAGLVSVVL
SAPEGNRNDVLNWAAYKAADVIMTGAAPAEAVVAALADAAAHIGLAPAETRGTIRSGLRA
GGVA
Download sequence
Identical sequences D3Q2C8
gi|291301676|ref|YP_003512954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]