SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291301768|ref|YP_003513046.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291301768|ref|YP_003513046.1|
Domain Number 1 Region: 64-367,494-526
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.95e-77
Family Type II chitinase 0.0000282
Further Details:      
 
Domain Number 2 Region: 720-772
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 9.68e-16
Family Carbohydrate binding domain 0.0045
Further Details:      
 
Domain Number 3 Region: 367-492
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000108
Family Chitinase insertion domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291301768|ref|YP_003513046.1|
Sequence length 772
Comment chitinase [Stackebrandtia nassauensis DSM 44728]
Sequence
MNRRFLSLVTPIAALVLAGVFGIMITGSAQADDAECRPDGLYKQSGVDVPYCDVYDTAGR
ETMDSPRRSIGYFASWRTGKDGTPAYLVNDIPWNKITHINYAFAHVKDDKISVGSPTASN
PAIGMEWPGVPGAEMDPDLSYKGHFNLLNKYKKQHPNVKTLISVGGWAETGGYFGDDGKR
VANGGFYTLAESQTKINTFADSVVDFLRKYGFDGVDIDYEYATSANHAGNPLDFQFSDSR
RATLMSGYVKLMKTIREKLNAASAADGKYYMSTAAVSASGWILRGSESYQVTEYLDYANI
MSYDLHGAWNHFVGPNAALYDDGTDSEMKHWNVYGTYGMGYLNTDWAYHYFRGSMPAGRI
NIGTPFYTRGWRNVNGGTNGLWGTSALADQTKCPAGTGGDVGSTVPCGDGALGIDNLWHD
KNTMGGEEPAGANPMWHAKNLEEGIQGSYIEDYGLDPENDPTDRLTGTYSRHYADTMEAP
WLWNADKKVFLSTEDEESMAAKTKFVIDQGLGGIMFWEMSGDYDWDADAGEYRMGTTLID
QIDAAFANAGPYDATKSNITMPDTQLNVDVTYSGYAVGDANYPINPTMTIKNNSSATIPG
GAVLEFDYATSAPCDMTQQSGWTLSTVKCGHTGGNTGGLKGDFQRVALTVPSWQTIAPGA
SVTVKIVYRLPISTPSNYVLKFGGKSYALSVDHPRLGDPGGDPTSSSSSPTSTPTTDPPD
QCTEAAWESTKVYNGGNKVSHKGHNWQAKWWTQGEEPGTTGEWGVWRDLGAC
Download sequence
Identical sequences D3Q3N6
WP_013019524.1.89426 gi|291301768|ref|YP_003513046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]