SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291302194|ref|YP_003513472.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302194|ref|YP_003513472.1|
Domain Number 1 Region: 128-193
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000222
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291302194|ref|YP_003513472.1|
Sequence length 204
Comment hypothetical protein Snas_4737 [Stackebrandtia nassauensis DSM 44728]
Sequence
MLKQDLKKVHRDLYGPKTEPELVEVPTRAFLMIDGHGDPDVESSGYGAAVEALYTVAYTL
RFALKKAEVIEYPVPPLEGLWWTDEFSDTPEWLRRDEWNWTMMIPQPPQVDAVGFADAVA
SARRKKGEREEFGRVRFEEFTEGLSAQILHIGPYSSEPETMERLNAFVKDKGLSWTGRHH
EIYLSDPRKAVPERMKTILRHGVG
Download sequence
Identical sequences D3Q7N7
gi|291302194|ref|YP_003513472.1| WP_013019950.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]