SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291302577|ref|YP_003513855.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302577|ref|YP_003513855.1|
Domain Number 1 Region: 43-250
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 8.95e-50
Family Endonuclease I 0.0019
Further Details:      
 
Domain Number 2 Region: 271-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-22
Family Proprotein convertase P-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291302577|ref|YP_003513855.1|
Sequence length 378
Comment endonuclease I [Stackebrandtia nassauensis DSM 44728]
Sequence
MRPTLRPALLTAALLTGSYLLLAAPASAHEPTAIPDGYYDAVDGLTGEALKSGLNDIISG
NDQLSYSEAKEALKETDADPSDPSKVVLIYNGTSVPASSSDWNREHVWAKSHGDFGTTIG
PGTDIHHLRPANPVVNSTRNNLDFDNGGKEVTQAPGNFYDSDSFEPRDADKGDVARMILY
MAVRYEGEDAFANLEPNDKVENNSAPFHGRLSVLKEWSAQDPPSTFEKNRNEVIYSKYQH
NRNPFIDHPEWVNTIWGGTPTDPPTCDPATNANPVTLRDNAIVTSDITVSGCTGNASTTS
QTTVDITHPNRGELSIYLYAPDGTYYVLKRTGDSGADLKHTYTVDLDTEPANGTWRLSVK
DYATGNTGTINSWTLNLG
Download sequence
Identical sequences D3QAW6
WP_013020333.1.89426 gi|291302577|ref|YP_003513855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]