SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291302699|ref|YP_003513977.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302699|ref|YP_003513977.1|
Domain Number 1 Region: 20-276
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.56e-42
Family Eukaryotic proteases 0.0064
Further Details:      
 
Domain Number 2 Region: 391-467
Classification Level Classification E-value
Superfamily PKD domain 2.09e-18
Family PKD domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291302699|ref|YP_003513977.1|
Sequence length 467
Comment peptidase S1 and S6 chymotrypsin/Hap [Stackebrandtia nassauensis DSM 44728]
Sequence
MRIARAVAVVAAATLLLSAPLAGTASADPPKSKAANPTDELRPDDVGTDIVNGELASYTE
RPSLITGLRVGGGGPQGSSCTASVVGKRQILTAAHCMIDVGGAKSYLYGDDDLSSAGDEK
WKSPVTKFTPHPDYGGSGGWRTGYDVAIVEVADDIPVPESDWAKFATSADADLSQPGRDS
LTYGWGKTAANGTMGRLKKTTLPINDADSCQVFDVTVNPELMICAGYDDGRTGICSGDSG
GPLIVDGVVIGITSWGASACDRYSIFARLTNAMGDWAHEQLQAPAEDDFSVSLSPDSATV
EPGQSTETTVSTKVSRGSAQDVSLTATGLPDGAEATFSPSAIRSGESAKLSVSTSSDTPQ
GTHRITVTADGAKVDRTAVFTLQVGEDGEGPTADFTAQCFSGPGVCFFNGQGSKGEIASY
RWTFGDGGTGQGQLVHHWYAAAGQYRVTLTVTDSRGGSHSTTKTITV
Download sequence
Identical sequences D3QBZ5
WP_013020455.1.89426 gi|291302699|ref|YP_003513977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]