SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291302759|ref|YP_003514037.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302759|ref|YP_003514037.1|
Domain Number 1 Region: 10-534
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.71e-215
Family Heme-dependent catalases 0.0000000000166
Further Details:      
 
Domain Number 2 Region: 537-695
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.5e-18
Family Catalase, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291302759|ref|YP_003514037.1|
Sequence length 702
Comment catalase [Stackebrandtia nassauensis DSM 44728]
Sequence
MTHEQADDPKDRQLGRDRVDDTDATLTTQQGVQVDHTDDSLSIGERGPTIMEDFHAREKL
THFDHERIPERVVHARGAGAYGHFKPYDSWLSEYTSAGFLTDPARQTPVFVRFSTVAGSR
GSADTVRDVRGFATKFYTRQGNYDLVGNNMPVFFIQDGVKFPDFVHAVKPEPHNEIPQAA
SAHDTLWDFVSLQPETLHMILWLMSDRALPRSYRMMQGFGVHTFRLVNAEGRGTFVKFHW
TPKLGTHSLVWDEAQKIAGKDPDFNRRDLWDSIEAGEFPEWELGVQLVDEADESEFDFDL
LDATKLIPEERVPVRPVGRMVLDRNPDNFFAETEQVAFHTANLVPGIDFSNDPLLQARNF
SYLDTQLIRLGGPNFAQLPVNRPVAEVHNDQRDGYGQHRIHTSRTSYTKNTLSGGCPVLA
DSGAFSHYAEKIEGHKIRERSDSFKDFYSQATLFWNSMSEVEAEHLVAAFRFELGKVEDT
DIRARVVEELNHVDHSLARRVAEGVGVEPPAKETTANHGRSSAALSQLNTRLDQPATRKV
AILVADGVDGDGTERLVASLRAQGLIPEKLAPTAGSVRAAGGGEIAVDRAINTMASVLYD
GVAVPCGSESVATLSVDGYALHFVAEAYKHAKPIACFGSGLDMLRAAGVNAELAATTEVT
VHLGVVTTTAARDELPDRFTEAFAAQLAAHRVWERNTDTVPA
Download sequence
Identical sequences D3PUS0
WP_013020515.1.89426 gi|291302759|ref|YP_003514037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]