SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291302926|ref|YP_003514204.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291302926|ref|YP_003514204.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily L21p-like 4.97e-34
Family Ribosomal protein L21p 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291302926|ref|YP_003514204.1|
Sequence length 104
Comment 50S ribosomal protein L21 [Stackebrandtia nassauensis DSM 44728]
Sequence
MYAIVKTGGKQYKAVEGDVLEVEKLAGEPGDTVTLPAVLLVDEGKVTTDAKALSGVTVNG
ELVDHFKGPKIKIHKFKNKTGYHKRQGHRQQLTRVKVTGISGGK
Download sequence
Identical sequences D3PVZ0
gi|291302926|ref|YP_003514204.1| WP_013020682.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]