SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291301960|ref|YP_003513238.1| from Stackebrandtia nassauensis DSM 44728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291301960|ref|YP_003513238.1|
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Cgl1923-like 6.67e-78
Family Cgl1923-like 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291301960|ref|YP_003513238.1|
Sequence length 282
Comment hypothetical protein Snas_4500 [Stackebrandtia nassauensis DSM 44728]
Sequence
MTPTDGLPDLRSPVLVAAFTGWNDAADAASHVIAHLSEQWQAEHTATIDPDPYYDFQMAR
PSVKVTAEGVERVDWPYTGFSVASPTDADRDVVLLTGAEPSMHWRGFCAEVAEICHSLGV
EQVILLGSLMADVGYTRPLPVSGTTNDPALAKRMKMDPVDYEGPAGIIAVLQATFQEAGV
PVTSCWVHVPHYAATSPCPKATLGLLHRVEELLDLPVPAGGLVEQTAQWENDVTQLVEAD
SDIADYISSLDEPQAGDEPSGDDIAKDFERYLRRRGPHTDDN
Download sequence
Identical sequences D3Q596
gi|291301960|ref|YP_003513238.1| WP_013019716.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]