SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261404492|ref|YP_003240733.1| from Paenibacillus sp. Y412MC10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|261404492|ref|YP_003240733.1|
Domain Number - Region: 18-184
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00012
Family Biotin synthase 0.073
Further Details:      
 
Domain Number - Region: 364-436
Classification Level Classification E-value
Superfamily CutC-like 0.00102
Family CutC-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261404492|ref|YP_003240733.1|
Sequence length 659
Comment peptidase U32 [Paenibacillus sp. Y412MC10]
Sequence
MARYFNGKEVELLAPAGTFEIFKTVIDANCDAVYFGGPSLNMRMMRKGYNLSYEEVGDAV
QLAHDRGKRAYITVNNLMNEEDLEEAKRYFAFLNEIGPDAIIAQDLAVFPLIQEMNYTNI
PVHSSVMMNVHNLEMIEALKALGVSRIVASREMDLKTAEVLQARSGMEFEYFVHGDMCTV
HGANCLYSSMLFGNSSNRGRCMKPCRWDYRVKKDGYLYPTEYPLAAKDMYMYESIPELIK
SGITSFKIEGRMRDTEFLLMVVNSYGDAIDRYIADPLGYNREAGADMLHKHRKRDFTTAY
AFGKPGLGFINRRYEGTGKFYSTGKVFSTPTAERETKEERVLQVKESLRHAKRERPDTSI
PQITVHVNTVEQARAALEEGAGVIYLTGDVFQPDRPFSRKDIEALTADKGDAEIVLGMPR
MMNELQMEQYHQFLSAGMEFNHYGLDGLLATNIGAMHKFQSIGLPLIADFSLNIYNHMAA
SFYQDHFGISRINPSLELQLHDLTKLLRHPEIPLEIIVHGSPIVMYLEHDLYANAAEFEP
IAEEDNRFVDNRHLVLLTDKGENPVYRDAAGRNHLALAKELCYMPILKELYEAGVHHFRI
EGKTYTTEQLRSLVRLYRQAASNLDACGRLYQSMAPVYAGFTLGSLQFGHSLELELTEA
Download sequence
Identical sequences D3EBW3
WP_012818816.1.35877 gi|261404492|ref|YP_003240733.1| 481743.GYMC10_0623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]