SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292489929|ref|YP_003532821.1| from Erwinia amylovora CFBP1430

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292489929|ref|YP_003532821.1|
Domain Number 1 Region: 130-462,491-564
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.81e-124
Family Amylase, catalytic domain 0.00000119
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily E set domains 9.6e-43
Family E-set domains of sugar-utilizing enzymes 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292489929|ref|YP_003532821.1|
Sequence length 658
Comment hypothetical protein EAMY_3468 [Erwinia amylovora CFBP1430]
Sequence
MMPIRDGQPTPRGASYDGKGVNFTLFSQNAGRVELCLFDDDDVETRLDLPARSGDTWHGY
LPAVRPGQRYGYRVHGPWLPQQGLLFNPAKLLLDPCARGIEGDVSDSPCFQSGEEQPDTL
DSGPLAPKSVVLADDFDWEGDSWPRIPWGSTVIYEAHVRGLTRLHSGIPAEMRGTYAALG
HPVMIDYFQRLGISSLQLLPVSSFASEPRLLRLGLSNYWGYNPLACYALESRYACGQNPR
EEFQQAVKALHQAGIEVILDVVFNHSAELDESGPMLSMRGIDNPNYYWLDQHGKYNNWTG
CGNTQNLSHPESVASTIDCLHYWVEECHIDGFRFDLATTLGRTPQYRRDAPLFQAIAADP
LLSQCKIIAEPWDVGPQGYQVGNFPLPFAEWNDHFRDTARRYWLHGDLSNGDFARRFAAS
SDLFKHEGRLPSCSINYITAHDGFTLRDVVSFEHKHNEANGEDNRDGSNNNYSYNHGVEG
PHAPLLVIEYRRRSVHALLTTLLLAQGTPMLLAGDEHGHSQHGNNNAYCQDNLLAWLDWK
HGDRGLFSFTAALIHLRRRIPALQQDGWWQEGDGNVEWLNGQGRPLNILEWEQGVHRMQI
RLSKHWLITLNATEDVCDLVLPPGQWHAIPPFAGEDNPILLTVWHGAAQGVCVFQEKT
Download sequence
Identical sequences D4I3J6 E5BA62
gi|292489929|ref|YP_003532821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]