SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292489346|ref|YP_003532233.1| from Erwinia amylovora CFBP1430

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292489346|ref|YP_003532233.1|
Domain Number 1 Region: 22-195
Classification Level Classification E-value
Superfamily E set domains 1.68e-49
Family E-set domains of sugar-utilizing enzymes 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292489346|ref|YP_003532233.1|
Sequence length 478
Comment GlcNac-binding protein A [Erwinia amylovora CFBP1430]
Sequence
MKVNKLALAITTLLVSGSVFAHGFVTNPPSRDTMCKLSKNSEEICSSSVRYDTSAIGEST
KGFPAEGTPPDGFLASGDNAKGYALNVQNADIWTKNKITAGKNNFTWELTAPHKTANFKY
FITKQGWDANKPLTRASFDLVPFCTIEGNGETPEPKPTHECVVPERTGYHVIYATWEVAD
TSNTFYKVIDVEFDGAVSSEWPKQVGTVNPYMDLKAGDSVKVRVFEDTEMTERSITLNID
SDAAGKKDLWSKALAEKINKEYQDLRAGSPNDDGGVEAVAGVNTIYTKKDSKIQSVEIDI
DSKQVMQLELDVNKLNNEYKLNKGAAKIEVTGTATAQSNLTATLTSKTRKQIDSQKVIVG
ADGKFALSLEGSKLKAGDYTVAVAVRAGNAEPVAKNQSIKLVENAGGGNVDADFTYPDNI
GSYVAGTKVLQPADGKVYQCKEGPVAGWCKIYAKSANHYEPGLGSNWGDAWTEVGAAK
Download sequence
Identical sequences D4HZY3
gi|292489346|ref|YP_003532233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]