SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476410214|ref|YP_007528040.1| from uncultured Sulfuricurvum sp. RIFRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476410214|ref|YP_007528040.1|
Domain Number 1 Region: 17-318
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 6.02e-75
Family Nitrous oxide reductase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|476410214|ref|YP_007528040.1|
Sequence length 320
Comment hypothetical protein B649_05155 [uncultured Sulfuricurvum sp. RIFRC-1]
Sequence
MKKTALSTILLLSIGVQADTVFVSNEKDNSISVIDSKTQKVTETIRVGQRPRGILLDKSK
TQLYVCASDDDTVQILDIKSKRVIANLPSGEDPEQFALHPNGRELYIANENDALVTIVDT
LKRSVLKQIEVGIEPEGMAVSPNGKLAIVTTETSNFLHWIDTKTKKIVHTTLVDQRPRHI
EFNKSGDKVWASSEIGGTVMVVDTASKKGIAKINFKIPGIFKDQIQPVGIKLTSDGKYAF
VALGPANHVAVVDAVTFKVIKYLLVGKRVWQMAFVENEQQLYTTNGVSGDVSVIDVNGLK
VLKSIKVGRYPWGLAVIPTN
Download sequence
Identical sequences K7S9E1
gi|476410214|ref|YP_007528040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]