SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|476410529|ref|YP_007528355.1| from uncultured Sulfuricurvum sp. RIFRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476410529|ref|YP_007528355.1|
Domain Number 1 Region: 32-179
Classification Level Classification E-value
Superfamily PEBP-like 1.2e-49
Family Prokaryotic PEBP-like proteins 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|476410529|ref|YP_007528355.1|
Sequence length 180
Comment hypothetical protein B649_06730 [uncultured Sulfuricurvum sp. RIFRC-1]
Sequence
MRLLSIISALLIAGGSSLFADNFTLKSENLLGQLTKTQEFSGFECDGKNISPELHWSDAP
KGTKSFAVTVYDPDAPTGSGWWHWVVFNIPSSVTSIPENFGDTTKKQPISAIQSITDFGK
AGFGGACPPKGDKPHRYMFTVHALDVDHLDLDDKASAALVGYMLGMHTIAKSTLISYYGR
Download sequence
Identical sequences K7SAA6
gi|476410529|ref|YP_007528355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]