SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|476410921|ref|YP_007528747.1| from uncultured Sulfuricurvum sp. RIFRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476410921|ref|YP_007528747.1|
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.09e-21
Family Ribosomal protein L9 C-domain 0.0007
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.01e-16
Family Ribosomal protein L9 N-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|476410921|ref|YP_007528747.1|
Sequence length 148
Comment 50S ribosomal protein L9 [uncultured Sulfuricurvum sp. RIFRC-1]
Sequence
MKVLLTKDVKGVGKTGEIKDVADGYGKNFLIGKGLALAATNEVLKKYESDQKKKAAHEAA
EIERLNTIKTQLADIKVVITKKLGNTGHIFGSVTKDEIADALNSQHHIQIDKKELDAKHG
IKTTGLHELDLKLGHGIHATLHLEIKGE
Download sequence
Identical sequences K7SET1
gi|476410921|ref|YP_007528747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]