SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434380965|ref|YP_006702748.1| from Brachyspira pilosicoli WesB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434380965|ref|YP_006702748.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000669
Family CheY-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434380965|ref|YP_006702748.1|
Sequence length 118
Comment putative CheY1 response regulator [Brachyspira pilosicoli WesB]
Sequence
MKENTVILVDDDGITLNKTKALLESSSIKVLTAENLYELMSKIYKYNIDTLIFNPNLVWI
NVIEFITELKKVNNELDFKIFFISENIDKSLKEEAKKLNIKYINNNSNINKIIQDLVK
Download sequence
Identical sequences D8IDZ2 J9U324 K0JH57
gi|300870995|ref|YP_003785866.1| WP_013244316.1.48933 WP_013244316.1.6222 WP_013244316.1.67631 WP_013244316.1.92922 gi|404477254|ref|YP_006708685.1| gi|431808191|ref|YP_007235089.1| gi|434380965|ref|YP_006702748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]