SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434382709|ref|YP_006704492.1| from Brachyspira pilosicoli WesB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434382709|ref|YP_006704492.1|
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily CheY-like 5.98e-36
Family CheY-related 0.0015
Further Details:      
 
Domain Number 2 Region: 287-422
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.74e-29
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00021
Further Details:      
 
Domain Number 3 Region: 148-271
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-25
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434382709|ref|YP_006704492.1|
Sequence length 426
Comment UDP-3-O-acyl-N-acetylglucosamine deacetylase [Brachyspira pilosicoli WesB]
Sequence
MIKNNILIIDDEEDILNACKNVLEDEGYDVDIAKNYEEALKTFESKKVDLVFLDVWLPNV
DGLDILSNIKEKYPYTAVIMMSGHAGVETAVRATKMGAYDFLEKPISVSKLLSSCDEIFK
KNENSIENNTSNNNNTHHHKTNNKYKVKQRTIAKSIVVSGFALMEGRKTALTLVPAEVNT
GIVFVDINTNTQIKLDHTNILSKDKSGAVNSTALVAGNRYIKTTEHFLAALHMMGITNLI
VKCDGEVPNVDGSALVFCDALREAGFVEQDDYIEPIVIDETLTYGNVNDNETYIILSPYN
GLEVSLRIDFAGTIGVQEYTYKFDNFEQFTEEVGRARSFNTIDNIDYAQKMGMAGSGMIG
SHILLCDGKVINTKLHFDNEFVRHKILDIIGDLYILGRPIIGRVVANKSSHSFNHSVVHD
LANRYL
Download sequence
Identical sequences K0JKD7
WP_014933586.1.67631 gi|434382709|ref|YP_006704492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]