SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434382119|ref|YP_006703902.1| from Brachyspira pilosicoli WesB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434382119|ref|YP_006703902.1|
Domain Number 1 Region: 232-377
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 8.89e-49
Family Peptidoglycan hydrolase LytM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434382119|ref|YP_006703902.1|
Sequence length 392
Comment M23/M37 family peptidase [Brachyspira pilosicoli WesB]
Sequence
MKNYIVFFVFLLSLSLYSQYDLKYVGKIEVLRDGKSSSFSNKVYDGDTIKTSKNAFAEIK
IKNKYYYLSENTSLSIKNGEINLVNGVYYTRANQFNSINDFKSYDKDLKVYVDPYPFYAG
KVSTIYVTSKDDVKIKNAKLMGSARPIVKFFELKDASDKMKVYKSVFGIYVGSQDKKYQF
QSNVELKDKTIATVALDIDLDFTPPPPKPKQIQGVTTTMKNIISNPQKSKEERELLNGKI
YISYTPTNYADSVYIMPAQGRYSSGFGAFRGYTKDYARYHQGFDIANTNGTPIIAANNGV
VRVSRELFVRGNCVVIDHGQGVYSSYFHMSKLIAKEGQYVKKGDIIGLIGSTGMSTGPHC
HWEMRAGNMTFDPLSILDKPTKFNVKVLTELK
Download sequence
Identical sequences K0JIS0
gi|434382119|ref|YP_006703902.1| WP_014933116.1.67631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]