SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434382948|ref|YP_006704731.1| from Brachyspira pilosicoli WesB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434382948|ref|YP_006704731.1|
Domain Number 1 Region: 124-365
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.83e-57
Family Peptidoglycan hydrolase LytM 0.00058
Further Details:      
 
Weak hits

Sequence:  gi|434382948|ref|YP_006704731.1|
Domain Number - Region: 24-73
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.017
Family Occludin/ELL domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434382948|ref|YP_006704731.1|
Sequence length 369
Comment peptidase [Brachyspira pilosicoli WesB]
Sequence
MRDTFETKSNIKLDEYYIQETSKDKSKVANKFVNNFKSNNKKQAAKYPKYYNKKTTYKKN
HNKLYHLKISISKIYDSTLPIRNFFNKIISAIMKKGNHERSILIFYNNEEKGLSLPINNF
MILFFVLIFASLIYTGFDAYYKQKEARDFYNTLSATEAKTYSLITEYKDSLNRYSKSLKD
YNDTIKNISYLIDYNNNSSFNNNSNNDNDINKTLNEIDRYQKNILTFMDVSSIIHKEIPV
GWPVAGGGRISSGFGARLSPFTQEKSYHYGVDIAGPYGTPILAAADGKVVFAGWKNGYGW
FVLIEHANGYQTGYGHNSELLVHGGQQVKRGQKIAMIGNTGRTTGIHCHFEVRIAGDHKN
PMPYLNARF
Download sequence
Identical sequences K0JHE0
gi|434382948|ref|YP_006704731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]