SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291285121|ref|YP_003501939.1| from Escherichia coli O55:H7 str. CB9615

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291285121|ref|YP_003501939.1|
Domain Number 1 Region: 133-343
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-44
Family Extended AAA-ATPase domain 0.00000721
Further Details:      
 
Domain Number 2 Region: 363-466
Classification Level Classification E-value
Superfamily TrpR-like 3.66e-38
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291285121|ref|YP_003501939.1|
Sequence length 467
Comment Chromosomal replication initiator protein dnaA [Escherichia coli O55:H7 str. CB9615]
Sequence
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNIN
GLLTSFCGADAPQLRFEVGTKSVTQTPQAAVTSNVAAPAQVAQTQPQRAAPSTRSGWDNV
PAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTH
LLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFF
ANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELE
TRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVR
EALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNH
SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS
Download sequence
Identical sequences A0A0F6CB19 A0A0F6FEG3 A0A0H3PRY9 A0A1Z3UXF5 A0A2H1BCH7 B5YXA4 C3SLL7 D3QW94 Q8XBZ3
gi|15833891|ref|NP_312664.1| gi|387884933|ref|YP_006315235.1| gi|209395729|ref|YP_002273228.1| gi|387509161|ref|YP_006161417.1| gi|254795705|ref|YP_003080542.1| 155864.Z5193 386585.ECs4637 444450.ECH74115_5130 544404.ECSP_4748 gi|291285121|ref|YP_003501939.1| NP_312664.1.58667 WP_000059116.1.10001 WP_000059116.1.100073 WP_000059116.1.10010 WP_000059116.1.100299 WP_000059116.1.100302 WP_000059116.1.100508 WP_000059116.1.100554 WP_000059116.1.100925 WP_000059116.1.101105 WP_000059116.1.101166 WP_000059116.1.101628 WP_000059116.1.10206 WP_000059116.1.102094 WP_000059116.1.102139 WP_000059116.1.10273 WP_000059116.1.10335 WP_000059116.1.10476 WP_000059116.1.10761 WP_000059116.1.10970 WP_000059116.1.1111 WP_000059116.1.11240 WP_000059116.1.11301 WP_000059116.1.11420 WP_000059116.1.11671 WP_000059116.1.11690 WP_000059116.1.12259 WP_000059116.1.12305 WP_000059116.1.12552 WP_000059116.1.13060 WP_000059116.1.13217 WP_000059116.1.13223 WP_000059116.1.13332 WP_000059116.1.13430 WP_000059116.1.13442 WP_000059116.1.13481 WP_000059116.1.13881 WP_000059116.1.13936 WP_000059116.1.13939 WP_000059116.1.14110 WP_000059116.1.14621 WP_000059116.1.14748 WP_000059116.1.15356 WP_000059116.1.15503 WP_000059116.1.15527 WP_000059116.1.1559 WP_000059116.1.15626 WP_000059116.1.15702 WP_000059116.1.15782 WP_000059116.1.16075 WP_000059116.1.16133 WP_000059116.1.16222 WP_000059116.1.16272 WP_000059116.1.16463 WP_000059116.1.16481 WP_000059116.1.16845 WP_000059116.1.17187 WP_000059116.1.1731 WP_000059116.1.17386 WP_000059116.1.17415 WP_000059116.1.17515 WP_000059116.1.17904 WP_000059116.1.18112 WP_000059116.1.18136 WP_000059116.1.18326 WP_000059116.1.1834 WP_000059116.1.18340 WP_000059116.1.1881 WP_000059116.1.18837 WP_000059116.1.18995 WP_000059116.1.19039 WP_000059116.1.191 WP_000059116.1.19140 WP_000059116.1.19419 WP_000059116.1.19840 WP_000059116.1.19847 WP_000059116.1.2005 WP_000059116.1.20264 WP_000059116.1.20449 WP_000059116.1.20480 WP_000059116.1.20546 WP_000059116.1.20594 WP_000059116.1.20745 WP_000059116.1.20893 WP_000059116.1.20941 WP_000059116.1.20950 WP_000059116.1.20989 WP_000059116.1.21508 WP_000059116.1.21666 WP_000059116.1.21668 WP_000059116.1.21962 WP_000059116.1.2218 WP_000059116.1.22251 WP_000059116.1.22304 WP_000059116.1.22381 WP_000059116.1.22594 WP_000059116.1.22743 WP_000059116.1.22925 WP_000059116.1.23073 WP_000059116.1.23115 WP_000059116.1.23241 WP_000059116.1.23323 WP_000059116.1.23355 WP_000059116.1.23467 WP_000059116.1.23790 WP_000059116.1.23838 WP_000059116.1.2388 WP_000059116.1.23895 WP_000059116.1.23899 WP_000059116.1.23973 WP_000059116.1.23984 WP_000059116.1.24070 WP_000059116.1.24283 WP_000059116.1.24341 WP_000059116.1.24753 WP_000059116.1.24870 WP_000059116.1.25076 WP_000059116.1.25082 WP_000059116.1.25088 WP_000059116.1.25201 WP_000059116.1.25305 WP_000059116.1.25577 WP_000059116.1.25794 WP_000059116.1.25819 WP_000059116.1.25831 WP_000059116.1.26066 WP_000059116.1.26105 WP_000059116.1.26121 WP_000059116.1.26134 WP_000059116.1.26246 WP_000059116.1.26474 WP_000059116.1.26525 WP_000059116.1.26590 WP_000059116.1.26761 WP_000059116.1.26878 WP_000059116.1.26975 WP_000059116.1.26998 WP_000059116.1.27338 WP_000059116.1.27445 WP_000059116.1.28143 WP_000059116.1.28551 WP_000059116.1.28734 WP_000059116.1.28879 WP_000059116.1.291 WP_000059116.1.29126 WP_000059116.1.29404 WP_000059116.1.29564 WP_000059116.1.29597 WP_000059116.1.29618 WP_000059116.1.2978 WP_000059116.1.29818 WP_000059116.1.29976 WP_000059116.1.30 WP_000059116.1.30019 WP_000059116.1.30052 WP_000059116.1.30064 WP_000059116.1.30164 WP_000059116.1.30476 WP_000059116.1.30637 WP_000059116.1.30918 WP_000059116.1.30993 WP_000059116.1.30999 WP_000059116.1.31055 WP_000059116.1.31252 WP_000059116.1.3140 WP_000059116.1.31401 WP_000059116.1.31575 WP_000059116.1.31715 WP_000059116.1.31956 WP_000059116.1.32063 WP_000059116.1.322 WP_000059116.1.32243 WP_000059116.1.32536 WP_000059116.1.32574 WP_000059116.1.32590 WP_000059116.1.32888 WP_000059116.1.32931 WP_000059116.1.3295 WP_000059116.1.33049 WP_000059116.1.33055 WP_000059116.1.33094 WP_000059116.1.33125 WP_000059116.1.33146 WP_000059116.1.33167 WP_000059116.1.33178 WP_000059116.1.33268 WP_000059116.1.33981 WP_000059116.1.34224 WP_000059116.1.34269 WP_000059116.1.34383 WP_000059116.1.34500 WP_000059116.1.34680 WP_000059116.1.34686 WP_000059116.1.35393 WP_000059116.1.3550 WP_000059116.1.36010 WP_000059116.1.36212 WP_000059116.1.36626 WP_000059116.1.36767 WP_000059116.1.36806 WP_000059116.1.37102 WP_000059116.1.37337 WP_000059116.1.37372 WP_000059116.1.3762 WP_000059116.1.37731 WP_000059116.1.37766 WP_000059116.1.37769 WP_000059116.1.3795 WP_000059116.1.38050 WP_000059116.1.38063 WP_000059116.1.38107 WP_000059116.1.38306 WP_000059116.1.38369 WP_000059116.1.38835 WP_000059116.1.389 WP_000059116.1.38958 WP_000059116.1.39180 WP_000059116.1.39268 WP_000059116.1.39310 WP_000059116.1.39415 WP_000059116.1.39564 WP_000059116.1.39601 WP_000059116.1.39646 WP_000059116.1.39820 WP_000059116.1.40113 WP_000059116.1.40234 WP_000059116.1.4030 WP_000059116.1.40549 WP_000059116.1.40629 WP_000059116.1.40742 WP_000059116.1.40758 WP_000059116.1.40793 WP_000059116.1.40882 WP_000059116.1.40900 WP_000059116.1.40952 WP_000059116.1.4103 WP_000059116.1.41060 WP_000059116.1.41330 WP_000059116.1.41478 WP_000059116.1.41536 WP_000059116.1.41734 WP_000059116.1.41849 WP_000059116.1.42036 WP_000059116.1.4213 WP_000059116.1.42447 WP_000059116.1.4250 WP_000059116.1.42513 WP_000059116.1.42594 WP_000059116.1.4261 WP_000059116.1.42863 WP_000059116.1.42975 WP_000059116.1.43079 WP_000059116.1.43121 WP_000059116.1.4313 WP_000059116.1.43140 WP_000059116.1.43196 WP_000059116.1.43384 WP_000059116.1.43448 WP_000059116.1.43469 WP_000059116.1.43536 WP_000059116.1.43604 WP_000059116.1.43754 WP_000059116.1.43798 WP_000059116.1.43816 WP_000059116.1.43837 WP_000059116.1.43911 WP_000059116.1.43939 WP_000059116.1.44125 WP_000059116.1.44203 WP_000059116.1.44389 WP_000059116.1.44488 WP_000059116.1.44561 WP_000059116.1.44733 WP_000059116.1.44906 WP_000059116.1.44954 WP_000059116.1.45020 WP_000059116.1.45076 WP_000059116.1.45195 WP_000059116.1.45293 WP_000059116.1.45404 WP_000059116.1.45575 WP_000059116.1.45841 WP_000059116.1.45901 WP_000059116.1.45941 WP_000059116.1.46039 WP_000059116.1.4619 WP_000059116.1.46282 WP_000059116.1.46283 WP_000059116.1.46369 WP_000059116.1.46414 WP_000059116.1.46451 WP_000059116.1.46503 WP_000059116.1.46597 WP_000059116.1.46611 WP_000059116.1.46626 WP_000059116.1.46810 WP_000059116.1.46832 WP_000059116.1.46913 WP_000059116.1.4708 WP_000059116.1.47140 WP_000059116.1.4723 WP_000059116.1.47411 WP_000059116.1.47784 WP_000059116.1.47827 WP_000059116.1.47954 WP_000059116.1.47994 WP_000059116.1.48065 WP_000059116.1.4812 WP_000059116.1.48176 WP_000059116.1.48226 WP_000059116.1.48258 WP_000059116.1.48697 WP_000059116.1.48712 WP_000059116.1.48792 WP_000059116.1.48806 WP_000059116.1.4931 WP_000059116.1.49332 WP_000059116.1.49401 WP_000059116.1.49464 WP_000059116.1.49496 WP_000059116.1.49567 WP_000059116.1.49655 WP_000059116.1.49771 WP_000059116.1.5003 WP_000059116.1.50110 WP_000059116.1.50345 WP_000059116.1.50358 WP_000059116.1.5037 WP_000059116.1.50380 WP_000059116.1.50549 WP_000059116.1.50762 WP_000059116.1.50986 WP_000059116.1.51154 WP_000059116.1.51171 WP_000059116.1.51643 WP_000059116.1.51693 WP_000059116.1.51834 WP_000059116.1.52039 WP_000059116.1.5217 WP_000059116.1.52496 WP_000059116.1.52543 WP_000059116.1.52883 WP_000059116.1.52933 WP_000059116.1.53084 WP_000059116.1.53181 WP_000059116.1.53211 WP_000059116.1.53252 WP_000059116.1.53270 WP_000059116.1.54024 WP_000059116.1.54213 WP_000059116.1.5441 WP_000059116.1.54454 WP_000059116.1.5467 WP_000059116.1.5486 WP_000059116.1.55218 WP_000059116.1.55286 WP_000059116.1.55492 WP_000059116.1.55820 WP_000059116.1.55838 WP_000059116.1.55892 WP_000059116.1.55897 WP_000059116.1.56072 WP_000059116.1.56151 WP_000059116.1.5639 WP_000059116.1.56392 WP_000059116.1.56481 WP_000059116.1.56489 WP_000059116.1.56491 WP_000059116.1.56554 WP_000059116.1.56571 WP_000059116.1.57032 WP_000059116.1.57068 WP_000059116.1.57071 WP_000059116.1.57180 WP_000059116.1.57197 WP_000059116.1.57280 WP_000059116.1.57453 WP_000059116.1.57466 WP_000059116.1.57610 WP_000059116.1.5764 WP_000059116.1.57646 WP_000059116.1.57836 WP_000059116.1.58048 WP_000059116.1.58057 WP_000059116.1.58169 WP_000059116.1.58238 WP_000059116.1.584 WP_000059116.1.58423 WP_000059116.1.5852 WP_000059116.1.58707 WP_000059116.1.58723 WP_000059116.1.59038 WP_000059116.1.59359 WP_000059116.1.59374 WP_000059116.1.59470 WP_000059116.1.59491 WP_000059116.1.59679 WP_000059116.1.59838 WP_000059116.1.59905 WP_000059116.1.59931 WP_000059116.1.59959 WP_000059116.1.60042 WP_000059116.1.60043 WP_000059116.1.60117 WP_000059116.1.6013 WP_000059116.1.60304 WP_000059116.1.60374 WP_000059116.1.60461 WP_000059116.1.60613 WP_000059116.1.60647 WP_000059116.1.60744 WP_000059116.1.60761 WP_000059116.1.60872 WP_000059116.1.60935 WP_000059116.1.61039 WP_000059116.1.61099 WP_000059116.1.61108 WP_000059116.1.61186 WP_000059116.1.61623 WP_000059116.1.61772 WP_000059116.1.618 WP_000059116.1.61874 WP_000059116.1.62182 WP_000059116.1.62480 WP_000059116.1.6261 WP_000059116.1.62675 WP_000059116.1.62843 WP_000059116.1.62888 WP_000059116.1.6331 WP_000059116.1.63445 WP_000059116.1.63586 WP_000059116.1.63615 WP_000059116.1.6364 WP_000059116.1.63872 WP_000059116.1.64086 WP_000059116.1.64161 WP_000059116.1.64371 WP_000059116.1.64621 WP_000059116.1.64946 WP_000059116.1.65035 WP_000059116.1.65084 WP_000059116.1.6511 WP_000059116.1.65118 WP_000059116.1.65194 WP_000059116.1.65372 WP_000059116.1.65546 WP_000059116.1.6587 WP_000059116.1.65875 WP_000059116.1.65898 WP_000059116.1.65963 WP_000059116.1.65978 WP_000059116.1.65988 WP_000059116.1.66033 WP_000059116.1.66100 WP_000059116.1.66531 WP_000059116.1.66566 WP_000059116.1.66873 WP_000059116.1.66922 WP_000059116.1.67073 WP_000059116.1.67136 WP_000059116.1.67150 WP_000059116.1.67214 WP_000059116.1.67446 WP_000059116.1.67533 WP_000059116.1.67676 WP_000059116.1.6769 WP_000059116.1.67726 WP_000059116.1.67753 WP_000059116.1.67775 WP_000059116.1.67780 WP_000059116.1.68096 WP_000059116.1.68411 WP_000059116.1.68493 WP_000059116.1.68523 WP_000059116.1.6880 WP_000059116.1.6887 WP_000059116.1.69054 WP_000059116.1.69350 WP_000059116.1.69351 WP_000059116.1.69780 WP_000059116.1.69810 WP_000059116.1.69818 WP_000059116.1.69896 WP_000059116.1.70123 WP_000059116.1.70125 WP_000059116.1.70517 WP_000059116.1.70539 WP_000059116.1.70576 WP_000059116.1.70713 WP_000059116.1.70723 WP_000059116.1.70787 WP_000059116.1.71003 WP_000059116.1.71099 WP_000059116.1.71205 WP_000059116.1.71225 WP_000059116.1.71226 WP_000059116.1.71269 WP_000059116.1.71448 WP_000059116.1.71840 WP_000059116.1.71940 WP_000059116.1.72016 WP_000059116.1.72180 WP_000059116.1.72322 WP_000059116.1.72427 WP_000059116.1.72614 WP_000059116.1.72641 WP_000059116.1.72694 WP_000059116.1.7291 WP_000059116.1.72913 WP_000059116.1.73126 WP_000059116.1.73343 WP_000059116.1.73626 WP_000059116.1.73801 WP_000059116.1.7392 WP_000059116.1.73934 WP_000059116.1.73968 WP_000059116.1.74251 WP_000059116.1.7429 WP_000059116.1.7446 WP_000059116.1.74521 WP_000059116.1.74536 WP_000059116.1.74828 WP_000059116.1.74904 WP_000059116.1.75030 WP_000059116.1.75164 WP_000059116.1.75248 WP_000059116.1.7536 WP_000059116.1.75382 WP_000059116.1.7539 WP_000059116.1.75507 WP_000059116.1.75536 WP_000059116.1.75694 WP_000059116.1.75767 WP_000059116.1.7583 WP_000059116.1.75989 WP_000059116.1.7608 WP_000059116.1.76189 WP_000059116.1.76407 WP_000059116.1.76448 WP_000059116.1.76477 WP_000059116.1.76697 WP_000059116.1.76827 WP_000059116.1.77099 WP_000059116.1.77128 WP_000059116.1.77239 WP_000059116.1.77275 WP_000059116.1.77392 WP_000059116.1.77644 WP_000059116.1.77707 WP_000059116.1.77760 WP_000059116.1.77961 WP_000059116.1.77979 WP_000059116.1.7799 WP_000059116.1.78063 WP_000059116.1.784 WP_000059116.1.7855 WP_000059116.1.78593 WP_000059116.1.78611 WP_000059116.1.79172 WP_000059116.1.7940 WP_000059116.1.79528 WP_000059116.1.79563 WP_000059116.1.79576 WP_000059116.1.79715 WP_000059116.1.79965 WP_000059116.1.80309 WP_000059116.1.80330 WP_000059116.1.80578 WP_000059116.1.80606 WP_000059116.1.81070 WP_000059116.1.81160 WP_000059116.1.81273 WP_000059116.1.81420 WP_000059116.1.81442 WP_000059116.1.81514 WP_000059116.1.81754 WP_000059116.1.81821 WP_000059116.1.81934 WP_000059116.1.81975 WP_000059116.1.82010 WP_000059116.1.82057 WP_000059116.1.82296 WP_000059116.1.82594 WP_000059116.1.82629 WP_000059116.1.8268 WP_000059116.1.82797 WP_000059116.1.83099 WP_000059116.1.83712 WP_000059116.1.84219 WP_000059116.1.84264 WP_000059116.1.84312 WP_000059116.1.84482 WP_000059116.1.84635 WP_000059116.1.84657 WP_000059116.1.8477 WP_000059116.1.85558 WP_000059116.1.85722 WP_000059116.1.85772 WP_000059116.1.86105 WP_000059116.1.86171 WP_000059116.1.86225 WP_000059116.1.86255 WP_000059116.1.86340 WP_000059116.1.86574 WP_000059116.1.86994 WP_000059116.1.87076 WP_000059116.1.87247 WP_000059116.1.87254 WP_000059116.1.87382 WP_000059116.1.87616 WP_000059116.1.88197 WP_000059116.1.8843 WP_000059116.1.88524 WP_000059116.1.88528 WP_000059116.1.88803 WP_000059116.1.88891 WP_000059116.1.89322 WP_000059116.1.89385 WP_000059116.1.89405 WP_000059116.1.89569 WP_000059116.1.89781 WP_000059116.1.89852 WP_000059116.1.89959 WP_000059116.1.90139 WP_000059116.1.90219 WP_000059116.1.90257 WP_000059116.1.90342 WP_000059116.1.90837 WP_000059116.1.90848 WP_000059116.1.90967 WP_000059116.1.9098 WP_000059116.1.90997 WP_000059116.1.91072 WP_000059116.1.91088 WP_000059116.1.91288 WP_000059116.1.91356 WP_000059116.1.91384 WP_000059116.1.91548 WP_000059116.1.91651 WP_000059116.1.9168 WP_000059116.1.91801 WP_000059116.1.91871 WP_000059116.1.93027 WP_000059116.1.93069 WP_000059116.1.93427 WP_000059116.1.93428 WP_000059116.1.93601 WP_000059116.1.93630 WP_000059116.1.93670 WP_000059116.1.93695 WP_000059116.1.93821 WP_000059116.1.94213 WP_000059116.1.9426 WP_000059116.1.94302 WP_000059116.1.94343 WP_000059116.1.94544 WP_000059116.1.94589 WP_000059116.1.94676 WP_000059116.1.94790 WP_000059116.1.94991 WP_000059116.1.95011 WP_000059116.1.95028 WP_000059116.1.95035 WP_000059116.1.95129 WP_000059116.1.95834 WP_000059116.1.96425 WP_000059116.1.96450 WP_000059116.1.96480 WP_000059116.1.96725 WP_000059116.1.96796 WP_000059116.1.97193 WP_000059116.1.9729 WP_000059116.1.9740 WP_000059116.1.97402 WP_000059116.1.97513 WP_000059116.1.97632 WP_000059116.1.9770 WP_000059116.1.97789 WP_000059116.1.97871 WP_000059116.1.98046 WP_000059116.1.98083 WP_000059116.1.981 WP_000059116.1.98176 WP_000059116.1.98187 WP_000059116.1.98205 WP_000059116.1.98279 WP_000059116.1.98312 WP_000059116.1.98384 WP_000059116.1.98569 WP_000059116.1.9883 WP_000059116.1.98920 WP_000059116.1.99101 WP_000059116.1.99182 WP_000059116.1.99234 WP_000059116.1.99487 WP_000059116.1.99501 WP_000059116.1.99692 WP_000059116.1.99986 gi|15804296|ref|NP_290335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]