SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289596436|ref|YP_003483132.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289596436|ref|YP_003483132.1|
Domain Number 1 Region: 250-350
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000889
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289596436|ref|YP_003483132.1|
Sequence length 410
Comment peptidase domain protein [Aciduliprofundum boonei T469]
Sequence
MRAAKILVTTIAAAMIFTGFFAIFAAAEGTSFDDAKVIGQGTYSGMVTSDYYYKVNVPAY
KAILVTLTAGNNAWVSLQIYNNERQDVGLWGHASANDGEKDYAFYDGKSVTSYAVYIKIS
NLHFFTSSNYTIQIEFRPGDVMAGAQEIEPGKNISGMLKGSLEAHWYKINVPPYKALLVT
LTAKSNSEIELELYNKNRESIGSPAYAENGGSDTTFYDAKSTSSYTVYLRIANSKLSEYS
GYTLRAEFRPGDVMAGAQGISNGQTISDEIKCSFEAHWYKINVPKGKLLNVSFTSNGGEI
DVTLYNSAGNVVDWKYGTKGYVNTETLGESGTIYIKVTAYEYHNTVNYTITPHLKTGSSD
VEQMSNVIATTCLGGIIIAIVIIVLIIILIVKVSRGKKEKTQIQQPPKTP
Download sequence
Identical sequences B5I9G1
WP_008082586.1.69060 WP_008082586.1.72259 gi|289596436|ref|YP_003483132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]