SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289596997|ref|YP_003483693.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289596997|ref|YP_003483693.1|
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-35
Family GHMP Kinase, N-terminal domain 0.0000895
Further Details:      
 
Domain Number 2 Region: 168-305
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.7e-33
Family Mevalonate kinase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289596997|ref|YP_003483693.1|
Sequence length 309
Comment mevalonate kinase [Aciduliprofundum boonei T469]
Sequence
METSAPAKVILFGEHAVVYGEPAIAVAINLRTYVKIKKSEEYRVNGYPMSDKYHSYIKNA
IKLCWDGEPLDIQTKSEVPSASGMGSSASITVAMLTALLAMKDELKEEKIAKLGFEVEYR
TQGSASPIDTSTVTHGKGILVHREKKDHFLWKVEKGELKWYIHHIEVPSLKLVVGFSGIK
GSTKDMVNKVRRFYNWNSFARDVIRDIGKITMEAIEPLQDEDYERIGELMNEDNKLLTIL
GVNHPMLKRMINASLKHSYGAKLTGAGGGGSIIALTDEQDEVAKAIEEVGGKAYKVEISK
DGFRIENHF
Download sequence
Identical sequences B5ICQ0
WP_008083833.1.69060 WP_008083833.1.72259 gi|289596997|ref|YP_003483693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]