SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289597103|ref|YP_003483799.1| from Aciduliprofundum boonei T469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289597103|ref|YP_003483799.1|
Domain Number 1 Region: 15-179
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.84e-31
Family MJ1460-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289597103|ref|YP_003483799.1|
Sequence length 181
Comment 4-vinyl reductase 4VR [Aciduliprofundum boonei T469]
Sequence
MGKEEIEKRSREIMKILGKDKNFSEDFKIELFGNRYILLSTTYFPYELMKDMEELFGGVG
DFVLYRGGKRVGRKLVRKYKKYVKDESLGIYDVISAVGWYFGWALGERIKEGENYRMILY
DSFEAESYMKNEGKSDKPVCHFMRGVLAGIVEEAEGSKYEGKELKCMVQGYNYCEFLIEK
V
Download sequence
Identical sequences B5ID00
WP_008084107.1.69060 WP_008084107.1.72259 gi|289597103|ref|YP_003483799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]