SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284163907|ref|YP_003402186.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284163907|ref|YP_003402186.1|
Domain Number 1 Region: 23-317
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.33e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 323-516
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.27e-35
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284163907|ref|YP_003402186.1|
Sequence length 700
Comment 5'-nucleotidase domain protein [Haloterrigena turkmenica DSM 5511]
Sequence
MAAGASAAAVLPTTGSVGANSRDETVTIVHDTHFHGRFADAEAAELSLASYYAVVEEHLE
SAANSLFVGNGDDLAPSMLGLEYEGEHVIEALNETAIDVDGVGNHEYDFGADVATARFEE
SEFPWVVANLLDDAGDPVPGTERWTAFEKGELTVGVFGLVSTNFHSLTDYPAEWQVLGYV
EGAQEAVDALREEGADVVVCASHVSTGVHYTLAEDVDGLDAIVGSHSNIVFEEPEVVDGT
IISEFGDEFDHVGSLTLDADGTLVDWRRTDLLAPDADPASAVDEYEEIEVRYADEIPEDE
TLATLAEEWTDELEAELEQTAFETEVELNATFDNYAIETNWGNLMTDAMRTVGEIGDIEV
DIAAQNAGGIRSGSTYGPGPVTGADVMNILPFPNEIEVVELTGEDVVAYLEEAIRPHPSE
NYGAQPAIQVSRLSYEWWGHGGESQVENVFVGGEPIDPDETYYLAHNDYSIENSDVLSEV
AVVLASGQFQGPYVLDRLEERDTVAPERENRMLRVDETVGEASVAVGDGETTLTVDVPDG
AAAIRSDTFRAVIRTGADLEANAATVDGDSVDVTFDTDELRALVADVDEPALRLFGGYDP
DQAYWDYGFEVPTSSGYEHFKLRADVSAAALEDPDDGDSDGNESDDDGANDGADDGMPGF
GPLGALAGGSAGGYLYSRRRVADDESAETTASATGDDGDD
Download sequence
Identical sequences D2RWC4
gi|284163907|ref|YP_003402186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]