SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284164379|ref|YP_003402658.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284164379|ref|YP_003402658.1|
Domain Number 1 Region: 9-61,216-416
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.4e-45
Family Bacterial dinuclear zinc exopeptidases 0.0088
Further Details:      
 
Domain Number 2 Region: 81-210
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000275
Family PA domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284164379|ref|YP_003402658.1|
Sequence length 454
Comment peptidase M28 [Haloterrigena turkmenica DSM 5511]
Sequence
MTDWIGDVFTSDVGWTHLETLVDIGTRMAGSDGEREAAERTRDALADAGTRNARLESFDI
QGWTRGESEISAGETSQNCIALPRSPADRATAPLVDLGYGLPADFEETDLEGKIAMVRSD
VPDYYDRYLHRREKYYHAVENGAMGFVYRNHVEGCLPPTGSVGSADPRSADSRTESDNVD
EDPIGEIPAVGVSSEVGARLARRFDGEEIELIVEADIGPATSQNVHAELGPDTDERVLVT
SHVDAHDIAEGAADNGAGTAMVVELANALAAREDDLETRVEFVAYGAEEVGLVGSTYHAE
RTDHDAIKAIVNNDGVVSDRTLSLTTHGFDGLEAAADEIAGRYDHPIETVPKLGPHSDHW
PFVQWGVPGYHVKSTSDEVGRGWGHTFADTIEKLEPRTLREQAILLTDLVVELAGEDATV
AHRDPEAIAADLEAQDLADGMRITGDWPYDEGAD
Download sequence
Identical sequences D2RZ61
gi|284164379|ref|YP_003402658.1| WP_012942294.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]