SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284164454|ref|YP_003402733.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284164454|ref|YP_003402733.1|
Domain Number 1 Region: 156-338
Classification Level Classification E-value
Superfamily SGNH hydrolase 9.99e-20
Family TAP-like 0.041
Further Details:      
 
Weak hits

Sequence:  gi|284164454|ref|YP_003402733.1|
Domain Number - Region: 42-88
Classification Level Classification E-value
Superfamily Urease, beta-subunit 0.0169
Family Urease, beta-subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284164454|ref|YP_003402733.1|
Sequence length 342
Comment hypothetical protein Htur_1168 [Haloterrigena turkmenica DSM 5511]
Sequence
MQQDGIQFHNVGDSRPVEGRDGQLLQRVPESVRTELNDGAQSRMRHPAGVELRFVPDGSA
TVTLSTVSGGSAEEGTVRVFWGPIQGSTEVVVGSEPTEIEVSPPEKLADLEPSAVEDLAF
DPRVCRIRLPGEHRGGPMVYHGVEGEVRPPRDAELPDRRYLAYGTSITEGEAPLAEHLTY
VSQTARRLDADLINLGSCGTAYCDAAMADHIAERDDWDVVTLSVSVNMVGTFDPETFRER
AANLIDRVASAHPEKPVVAITIFRNSMDVCRSNGETELCERFREELREIVAETTHDNVHL
LEGPELLPTIGGLTTDLVHPGDNAMITMGETLATELEPLIED
Download sequence
Identical sequences D2RZD6
WP_012942366.1.92728 gi|284164454|ref|YP_003402733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]