SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284165812|ref|YP_003404091.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284165812|ref|YP_003404091.1|
Domain Number 1 Region: 2-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-40
Family GHMP Kinase, N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 187-305
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.32e-30
Family Mevalonate kinase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284165812|ref|YP_003404091.1|
Sequence length 328
Comment mevalonate kinase [Haloterrigena turkmenica DSM 5511]
Sequence
MAVSSAPGKVYLFGEHAVVYGEPAVPCAIELRARVDVEQRTDSKLRVHAEDLSLDGFTVE
YAGEPEGRPDVDVSESLLNAAMGYVDSAIEQVRDVTGEDDVGFDVTIESDIPLGAGLGSS
AAVAVAAIDAGTRELGTTLEIDELAERAYRTEHEVQGGQASRADTFCSATGGAVRVEGDD
CRSLEAPELPIVIGFDGGAGDTGELVAGVRDLREEYEFAADTVEAIGDIVRRGEDALAAG
DIEELGRLMNFNHGLLSALGVSSRTLDSMVWAARDAGALGAKLTGAGGGGCIVGLDDTNE
TETALSYTLGCEDAFRAELAETGVERLE
Download sequence
Identical sequences D2RVY9
WP_012943696.1.92728 gi|284165812|ref|YP_003404091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]