SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284166930|ref|YP_003405209.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284166930|ref|YP_003405209.1|
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Globin-like 3.49e-34
Family Truncated hemoglobin 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284166930|ref|YP_003405209.1|
Sequence length 121
Comment globin [Haloterrigena turkmenica DSM 5511]
Sequence
MSETLYERLGGQDAIGAVVDQFYERVVEDEQVAHYFEDVDMQKQRAHQTQFISAVAGGPV
DYSGENMEAAHDDLGITRPDFYVIVEHLDATLREFDVDPDDREAVLDAIAEYEGDIVTAT
A
Download sequence
Identical sequences D2RRR9
WP_012944783.1.92728 gi|284166930|ref|YP_003405209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]