SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284166957|ref|YP_003405236.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284166957|ref|YP_003405236.1|
Domain Number 1 Region: 21-429
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-128
Family Tandem AAA-ATPase domain 0.000000000264
Further Details:      
 
Domain Number 2 Region: 52-83,471-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.27e-34
Family Tandem AAA-ATPase domain 0.00000184
Further Details:      
 
Domain Number 3 Region: 630-668
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.0000000114
Family C-terminal UvrC-binding domain of UvrB 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284166957|ref|YP_003405236.1|
Sequence length 687
Comment excinuclease ABC subunit B [Haloterrigena turkmenica DSM 5511]
Sequence
MSDSDSRGPLQPDRPDVDRPFTVDAPFEPAGDQPEAIEQLAEGFRQGMDKQTLLGVTGSG
KTNTVSWLIEEIQKPTLVIAHNKTLAAQLYEEFRNLFPENAVEYFVSYYDYYQPEAYVEQ
TDTYIDKDASINDEIDRLRHSATRSLLTREDVIVVASVSAIYGLGDPRNYVDMSMRLEVG
EEVGRDELLKRLVDLNYERNDVDFTQGTFRVRGDTVEIYPMYGRYAVRVELWGDEIDRMV
KVDPLEGKTQGDQQAVLVHPAEHYSIPETTLEEAMDEIRTDLDKRISYFERQGDMIAAQR
IEERTSFDLEMMQETGYCSGIENYSVYLSDRESGDAPYTLLDYFPDDFLTVVDESHVTLP
QVRGQYAGDKSRKDSLVENGFRLPTAYDNRPLTFEEFQEKTNQTLYVSATPGDYEREESD
QIVEQIVRPTHLVDPEIEVSPASGQIDDLMDRIDERIARDERTLVTTLTKRMAEDLTEYL
EEAGVDVAYMHDETDTLERHEIIRSLRLGEIDVLVGINLLREGLDIPEVSLVAILDADQE
GFLRSETTLVQTMGRAARNVNGEVVLYADDPSNAMESAIEETQRRRRIQQEYNEEHGLEP
TTIEKEVGETNLPGSKTETTQVSGREIEDEEEAERYIAELEDRMDEAASNLEFELAADIR
DRIREVREEFDLAGGEDEGIAPPTEEF
Download sequence
Identical sequences D2RRU6
WP_012944809.1.92728 gi|284166957|ref|YP_003405236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]