SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284172547|ref|YP_003405929.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284172547|ref|YP_003405929.1|
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily SGNH hydrolase 3e-50
Family YxiM C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284172547|ref|YP_003405929.1|
Sequence length 230
Comment lipolytic protein G-D-S-L family [Haloterrigena turkmenica DSM 5511]
Sequence
MSSEQITVHLIGDSTIAEKEASARPETGWGMPFADRFDDSVTVENHARNGRSTRTFLEEG
RWEPVVRDLTETHYVFIQFGHNDEVPSKEQYTTEAEFTANLEKFVDETRECGASPVLLTP
VARRHFDEEGTPKDTHRVYSELTREVARDRDVPLIDADERSRSLLSELGPEESTSLYLHL
SPGEHSNYPDGVTDDTHFSEYGARRMAELVLDGIEELNLELASRVVLDDR
Download sequence
Identical sequences D2S1K9
WP_012945500.1.92728 gi|284172547|ref|YP_003405929.1|NC_013745 gi|284172547|ref|YP_003405929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]