SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284172877|ref|YP_003406258.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284172877|ref|YP_003406258.1|
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Globin-like 5.6e-26
Family Truncated hemoglobin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284172877|ref|YP_003406258.1|
Sequence length 108
Comment globin [Haloterrigena turkmenica DSM 5511]
Sequence
MITAVVDEFYDRIMADEQVADYFDDGDMQKQRAHQAQFISSVTGGPVKYSGGEMKTIHAD
MGITPSDFQAIATHFDGALVEFDVNEDDRQAVLEEIASSQEAIVTAAD
Download sequence
Identical sequences D2S2I8
gi|284172877|ref|YP_003406258.1| gi|284172877|ref|YP_003406258.1|NC_013746 WP_012945828.1.92728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]