SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284172920|ref|YP_003406301.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284172920|ref|YP_003406301.1|
Domain Number 1 Region: 20-248
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.4e-30
Family Alanine racemase-like, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284172920|ref|YP_003406301.1|
Sequence length 371
Comment alanine racemase [Haloterrigena turkmenica DSM 5511]
Sequence
MAPTLYQPVEDLETPALLVDIDAMERNIEEYAAVADENDVTLRSHIKTHKNAELAALEDE
MTDGGGICCQTLGEVETMARNGIDDIYLSYQVVGERKLDRFCWLSQKVEKLATTVDSAAT
IDLLQDAAQAHEITADVILEVDVGLHRTGVAPGPEAVALAERIDEAANLSFDGILAYESH
VKAEAETESEFDELCWEAMELGEDVVDDIEAAGIPVDEVKVGGTATSRYSGKHPVVTEIN
PGMYPFNDVGELELRPWEVSKDDCAATIVTTVISVPDDDRLVVDGGSKTFSLDKPQMPVP
KNRDDIEYANASEEHGWIDTSNSDESFAVGDRLEFIVPHVCTTINLHDLIIGVRDDQVEE
LWEVQARGKVR
Download sequence
Identical sequences D2S2N1
gi|284172920|ref|YP_003406301.1|NC_013746 WP_012945871.1.92728 gi|284172920|ref|YP_003406301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]