SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284176142|ref|YP_003406419.1| from Haloterrigena turkmenica DSM 5511

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284176142|ref|YP_003406419.1|
Domain Number 1 Region: 5-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.19e-26
Family Nitrogenase iron protein-like 0.088
Further Details:      
 
Domain Number 2 Region: 351-417
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0000222
Family Mitotic arrest deficient-like 1, Mad1 0.0083
Further Details:      
 
Domain Number 3 Region: 525-582
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000044
Family Iron-dependent repressor protein 0.089
Further Details:      
 
Weak hits

Sequence:  gi|284176142|ref|YP_003406419.1|
Domain Number - Region: 273-376
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0471
Family HBL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284176142|ref|YP_003406419.1|
Sequence length 595
Comment hypothetical protein Htur_5115 [Haloterrigena turkmenica DSM 5511]
Sequence
MSDQRQILVGETDDGSELRLPVVELLTGRGFVTGKSGSGKSNTASVIAEELLEAGFPLLI
VDTDGEYYGLKEEYEMLHAGADEECDIQIGPEHAEQMASLALEENVPIILDVSGYLDEEV
ADELLRKIARQLFVKEKKMKKPFLLVVEEVHEYIPEGGGVGETGNLLIKISKRGRKHGLG
ILGISQRPADVKKDFITQANWLVWHRLTWDNDTKVVGRIIDTEYSELVSELNDGQAFVQT
DWTEVDVRKVQFRRKRTFDAGATPGLDDFERPELKSVSDALVGDLENISERKEREQDRIN
ELENELEKKEKRIETLEDELESARDVSSAAKQMADALTRKETVQTELGGGSDEELRRLHD
EIVDLEDERDELRAELEERDERIETLETTLESRTETVERLREENERLRDRVRELEESEPE
PETTPTESDDEIVHAGGDAVEFGFTSIREELEKRDEATSDSDRDETTRNDTGRTEVERDE
FERNEVERDERTTTASERPSFEALFEGDWIDDRLETAAGQSQCTAATGRRALAVLARDGP
LETAVLAERVDRSTVAVQSLLSELRTEGVLDRPTERTYTLSDDVRGELTAAARID
Download sequence
Identical sequences D2S2Z9
gi|284176142|ref|YP_003406419.1| gi|284176142|ref|YP_003406419.1|NC_013747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]