SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288559390|ref|YP_003422876.1| from Methanobrevibacter ruminantium M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288559390|ref|YP_003422876.1|
Domain Number 1 Region: 125-255
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.98e-28
Family MJ1460-like 0.036
Further Details:      
 
Domain Number 2 Region: 30-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-16
Family ArsR-like transcriptional regulators 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288559390|ref|YP_003422876.1|
Sequence length 264
Comment transcriptional regulator ArsR family [Methanobrevibacter ruminantium M1]
Sequence
MENEENISQPKAIQIFAKAPGELGVNVVKSPVKLTILSMLKDTDMEFDEIVKNTGKSKST
ISVHLKSLREDGIVSYRFDANDHRKKIFYISSKFLGEVESGDEKELEERQAEFLVKNILD
VDNFKFSFLLFHTLRSNLIQEGININPVLNQTGKNIGAAMYEKLYDDDIKVFCDNITEFW
ADNGLGKLDIVLGDIINVTAYECFECSLLPKKGKPACYLDAGIFEALFANYLKKDIAVTE
VKCFTMGDDCCHFLVEGINGESLT
Download sequence
Identical sequences D3DYR4
gi|288559390|ref|YP_003422876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]