SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288560177|ref|YP_003423663.1| from Methanobrevibacter ruminantium M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288560177|ref|YP_003423663.1|
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.11e-36
Family GHMP Kinase, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 178-319
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.01e-32
Family Mevalonate kinase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288560177|ref|YP_003423663.1|
Sequence length 327
Comment mevalonate kinase Mvk [Methanobrevibacter ruminantium M1]
Sequence
MRKMSVASAPGKTILFGEHSVVYDEPAIAGAVNKRASVKIQESLNNYSTLKSYDLGFEVI
LNTRRGTYKLVKGKPGIIRYILNAMGKFHDHSNIDMTLGLNLPIGSGLGSSAAVTVATIA
ALHDYHGVPITKEKLAEEAHGVEQDVQGIASPLDTLVSTNGGLVYLSREKRIVRFDKPLD
APFVIGFTNKYGNTGKMVKHVRHLKDNYPELINPVISTMGKIANEARIAILKNDIDRIAD
LMNLNQGLLDGLGVNTYELSRMIYTARENGALASKITGSGGGGSIISLCKNSTVDNVANA
INKEDSTIKVKFSGEGVLVNRRSPPFN
Download sequence
Identical sequences D3E2L0
WP_012955722.1.7700 gi|288560177|ref|YP_003423663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]