SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288956843|ref|YP_003447184.1| from Azospirillum sp. B510

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288956843|ref|YP_003447184.1|
Domain Number 1 Region: 8-197
Classification Level Classification E-value
Superfamily ITPase-like 3.66e-43
Family Maf-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288956843|ref|YP_003447184.1|
Sequence length 204
Comment septum formation protein [Azospirillum sp. B510]
Sequence
MSAPLPLPQLVLASGSRTRAAMLEQAGVSAILDKPLVDEDEVKAAGRAEGVPADIVAEAL
AELKAQRITRRHPGALVVGADQMLECEGRWFDKPADLAAARAQLLDLRGRTHRLVSCAVV
VRDGERIWHKVDSARLTMRNFTEAFLDEYLTRVGDDVLHSVGAYQLEGLGAQLFQRVEGD
FFTILGLPLLPLLGFLRVHGVGRE
Download sequence
Identical sequences D3NQG1
WP_012972630.1.27297 gi|288956843|ref|YP_003447184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]