SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288962733|ref|YP_003453027.1| from Azospirillum sp. B510

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288962733|ref|YP_003453027.1|
Domain Number 1 Region: 583-1050
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-125
Family ALDH-like 0.000000363
Further Details:      
 
Domain Number 2 Region: 206-556
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.45e-117
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000307
Further Details:      
 
Domain Number 3 Region: 32-205
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.79e-60
Family N-terminal domain of bifunctional PutA protein 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288962733|ref|YP_003453027.1|
Sequence length 1244
Comment 1-pyrroline-5-carboxylate dehydrogenase [Azospirillum sp. B510]
Sequence
MIDPSVSPAAEFSPDSGTGPFAAFAPVVRPASPLRQAITAAYRRPEPDCVAWLVEQAALP
AEVTAAAARTARSLIAALRARPQGRGVEGLIHEYSLSSQEGVALMCLAEALLRIPDRATR
DALIRDKIAGGDWRAHLGNSPSLFVNAATWGLLVTGKVTGVLGDHFGGEQALSSALTKLI
LRGGEPLIRRGVDFAMRMMGEQFVTGQTIDEALANSRGMEAEGFRYSYDMLGEAATTAAD
ADRYYADYEKAIHAIGKASAGRGIHDGPGISIKLSALHPRYSRAQGQRVMAELLPRVTEL
ARLARRYDIGLNIDAEEADRLELSLDLLESLCFDPDLAGWNGIGFVVQAYGKRCPYVIDF
VVDLARRSGHRLMIRLVKGAYWDSEIKRAQVDGLEDFPVYTRKLHTDVSYVACARRLLGA
PDAVFPQFATHNAQTLATIHRMAEHLNPAGFQVGQYEFQCLHGMGEPLYKEVVGPLKRPC
RVYAPVGTHETLLAYLVRRLLENGANSSFVNRIADKSVSIDDLVADPVAQASATLPLGER
NPLIALPKDLFGAERANSAGLDLSNETTLAGLSAALRDSAAIAWTAAPLLADGERRGEHP
GKARPVLNPADRRDIVGRRVDAGPADIADAFLFAEAAAPVWAATPPAERAACLFRAADAM
QARLPTLLGLIIREAGKSTANAIAELREAIDFLRYYGAQVRDRFANDTHLPLGPVVCISP
WNFPLAIFTGQVAAALAAGNPVLAKPAEETPLVATEAVRILRAAGVPAGAVQLLPGAGEV
GAALVGHAGTRAVMFTGSTEVARLIQRQLAERLSPDGAPIPLIAETGGQNAMIVDSSALA
EQVVADVIASAFDSAGQRCSALRILCLQEDVADRTLTMLKGAMRELGIGSPDRLAVDVGP
VITAEARDGILRHIEAMRAKGRRVESLPLPAETGHGTFVAPTIIEIDRIADLEREVFGPV
LHVLRFRRDDLDRLVDAINGTGYGLTFGLHTRIDATIDRVTSRIEAGNLYVNRNTIGAVV
GVQPFGGHGLSGTGPKAGGPLYLSRLLSVRPLPDLGVRGGTERALAHNFAGWLADQGKAA
IATEVRALAKHSPVGGRTELAGPVGESNVYSLMPRGRILLLPRTEDGLYRLLGAALATGN
EVVVDGDTAVTAGLTRLPPEVAARVRVSPSWTSFGPLAGALVEGESERLLAANRRIAELP
GPIVLTQGVPTGGKGVEIAWLMNERSVSTNTTAAGGNASLVAMS
Download sequence
Identical sequences D3P754
gi|288962733|ref|YP_003453027.1|NC_013859 gi|288962733|ref|YP_003453027.1| WP_012978279.1.27297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]