SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406025903|ref|YP_006724735.1| from Lactobacillus buchneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406025903|ref|YP_006724735.1|
Domain Number 1 Region: 6-85,179-350
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.82e-51
Family Bacterial dinuclear zinc exopeptidases 0.00039
Further Details:      
 
Domain Number 2 Region: 73-184
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.36e-23
Family Aminopeptidase/glucanase lid domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|406025903|ref|YP_006724735.1|
Sequence length 358
Comment aminopeptidase I zinc metalloprotease [Lactobacillus buchneri CD034]
Sequence
MDKKSALNLIEHLSNANGPSGFEDEVKDYVVQTASSFSSVHADHMNNVYLKNNQNSPSKG
KTLMLDSHLDAVGLIVQAVKPNGTIKFVPLGGWVPANLTAEKMRIRNQDGEWITGLVATK
PPHFMTEAEKKKPIDIANLVIDVGTNSAEETKEVLKIDTGCPIAPDTEWEYFKTQDVMMG
KAFDNRIGTACLMTAMSDLAEENLDVNLVGAIASQEEVGCRGAKVTVKKVHPDIAICLEG
CPADDTFTPEWLIQTGLKRGPMLRDMDTSFIANPHFQQLAVDQAHQNGIPFTRAVRTGGG
IDGSELLEFQGAPTICIGIPVRYEHTNYGFVAYSDFENTVKLLKAIILSLNDKVIDGL
Download sequence
Identical sequences A0A0R1JE88 F4FVP5 J9VXF7
gi|331700458|ref|YP_004397417.1| gi|406025903|ref|YP_006724735.1| WP_013726917.1.33153 WP_013726917.1.68932 WP_013726917.1.95301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]