SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406027059|ref|YP_006725891.1| from Lactobacillus buchneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406027059|ref|YP_006725891.1|
Domain Number 1 Region: 3-202
Classification Level Classification E-value
Superfamily Formyltransferase 1.96e-63
Family Formyltransferase 0.00000698
Further Details:      
 
Domain Number 2 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.2e-26
Family Post formyltransferase domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|406027059|ref|YP_006725891.1|
Sequence length 314
Comment Methionyl-tRNA formyltransferase [Lactobacillus buchneri CD034]
Sequence
MTTVVFMGTPQFAVPILQGLLDQKYDILCVVTQPDRPVGRKHRISQSPVKQAAVANHLPV
FQPEKLSGSPEMQRVIDFHPDLIVTAAYGQFLPTKMLNAVKIAAVNVHGSLLPKYRGGAP
VQYAIMNGDSETGISLIYMVKKMDAGDILAQKAVPIQPDDDTETMFDKLSIVGRDLLLAT
LPKVIAGDISPVPQDEDQVVFSPNIKPEEEQLDFNQTAFMVNAKVRALRPDPVAYTVING
KRTKIWGAQVVDQTTEMAPGSVVEKTKHQLLLSAGKGTVLSIQELQPAGKPKQQITDYLN
GIGQSLKVGQQVIK
Download sequence
Identical sequences J9W1N3
WP_014940002.1.95301 gi|406027059|ref|YP_006725891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]