SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406027297|ref|YP_006726129.1| from Lactobacillus buchneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406027297|ref|YP_006726129.1|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.88e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.66e-28
Family Ribosomal protein L11, C-terminal domain 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|406027297|ref|YP_006726129.1|
Sequence length 141
Comment 50S ribosomal protein L11 [Lactobacillus buchneri CD034]
Sequence
MAKKVANIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVITV
YEDRSFDFITKTPPAAVLLKKAAGVQKGSGEPNTNKVATVTKDQVKEIAETKMKDLNAAD
VEAAMRMVEGTARSMGFTVEG
Download sequence
Identical sequences A0A0R1J9P9 A0A0R1LAM4 A0A0R1YVL3 A0A1E7XD22 A0A1X1FD26 A0A269YIB9 F4FRA9 J9W4H9 S4NA75
gi|406027297|ref|YP_006726129.1| gi|331701821|ref|YP_004398780.1| WP_013728260.1.11831 WP_013728260.1.16809 WP_013728260.1.17689 WP_013728260.1.17992 WP_013728260.1.20344 WP_013728260.1.20414 WP_013728260.1.20433 WP_013728260.1.23867 WP_013728260.1.26333 WP_013728260.1.33153 WP_013728260.1.35467 WP_013728260.1.35860 WP_013728260.1.36782 WP_013728260.1.37933 WP_013728260.1.41016 WP_013728260.1.42645 WP_013728260.1.43164 WP_013728260.1.44146 WP_013728260.1.51616 WP_013728260.1.5232 WP_013728260.1.58899 WP_013728260.1.62820 WP_013728260.1.68092 WP_013728260.1.68932 WP_013728260.1.74708 WP_013728260.1.78916 WP_013728260.1.83312 WP_013728260.1.86827 WP_013728260.1.91767 WP_013728260.1.95301 WP_013728260.1.97973 WP_013728260.1.99177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]