SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291276751|ref|YP_003516523.1| from Helicobacter mustelae 12198

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291276751|ref|YP_003516523.1|
Domain Number 1 Region: 38-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000556
Family HLH, helix-loop-helix DNA-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291276751|ref|YP_003516523.1|
Sequence length 128
Comment hypothetical protein HMU05210 [Helicobacter mustelae 12198]
Sequence
MKIIVLALLYCSGIFAREILCEQRLDMLSQSLEIAAKKSDHSRQNSLRAQMEKLKAHCNN
AEILQETQNYIKELQTQMAHHKKALQEAKLSKNETEIKKQMLEIELLHPQIIAAKLELLR
LKDKIKNP
Download sequence
Identical sequences D3UH10
gi|291276751|ref|YP_003516523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]