SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091005519m|PACid:23532017 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091005519m|PACid:23532017
Domain Number 1 Region: 81-311,432-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.28e-71
Family Tandem AAA-ATPase domain 0.000000637
Further Details:      
 
Domain Number 2 Region: 775-994
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 4.19e-59
Family Helical scaffold and wing domains of SecA 0.0000317
Further Details:      
 
Domain Number 3 Region: 480-589,678-769
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-49
Family Tandem AAA-ATPase domain 0.00000946
Further Details:      
 
Domain Number 4 Region: 310-432
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 7.85e-43
Family Pre-protein crosslinking domain of SecA 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091005519m|PACid:23532017
Sequence length 1032
Sequence
MASSSLCSSFTSKTWNPRTLYHHKTLTPPASAFFRGDLLLHPPSFTDIRRSRRHRSGVVA
SLGGLLGGIFKGADTGESTRQQYAATVNIINRLEPEISALSDSELRERTFALRERAQQGQ
SLDSILPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLVAVLPAYL
NALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTSQQRKENYSCDITYVT
NSELGFDYLRDNLATENFNFHPFNNVLNSSELWNVQSVEDLVVRGFNYCIIDEVDSILID
EARTPLIISGPAEKPSDQYYKAAKIAVAFERDIHYTVDEKQKTVLLSEQGYEDAEEILAV
KDLYDPREQWASYILNAIKAKELFLRDVNYIIRGKEVFIVDEFTGRVMQGRRWSDGLHQA
VEAKEGLPIQNETVTLASISYQNFFLQFPKLCGMTGTAATESTEFESIYKLKVTIVPTNK
PMIRKDESDVVFRATSGKWRAVVVEISRMHKTGRPVLVGTTSVEQSDSLSELLKEAEIPH
EVLNAKPENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLREILMPR
VVKPAEEGFVSIKKPPPYKTWKVNEKLFPCQLSNKNVNLTEKAVQLTVETWGKRSLTELE
AEERLSYACEKGPAQDEVISKLRNAFLEIGKEYKVFTEEERKKVVEAGGLHVVGTERHES
RRIDNQLRGRSGRQGDPGGSRFFLSLEDNIFRIFGGDRIQGLMRAFRVEDLPIESKMLTK
ALDEAQRKVENYFFDIRKQLFEYDEVLNSQRDRVYTERRRALESDNLQSLLIEYAELTMD
DILEANIGSDAPKDSWDLEKLIAKIQQYCHMLNDLTPDFLKNECSDYEALRNYLRLRGRE
AYRQKRDIVEEQATGLMKEAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIE
YKLEGYNLFLDMMAQIRRNVIYSVYQFQPVLLKQDQDKINNGKSGKRKARTSVNPNPDPV
GTIEPSTSTTAS
Download sequence
Identical sequences Phvulv091005519m|PACid:23532017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]