SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091013862m|PACid:23538279 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091013862m|PACid:23538279
Domain Number 1 Region: 98-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000118
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091013862m|PACid:23538279
Sequence length 214
Sequence
MQGEKDPQKWHENIFGNKRCKHSQNIAEELGEASRFKDGGDVSLENLDQEAEFLSESSSP
EVCFSSQEHLIRDSYSPSSLPAMENFREYILEHGEPLHKKLTTSDVNVNQNRLLLNKNHV
EKSFLPLLKNDENIERGIQVPVYDAHQNTFSLTFKKWTNKYYVLNGGWKDFFQVHKLQKD
DSITVCIFRHSSHNKLCFALDYKKIGGDKIQNLS
Download sequence
Identical sequences V7BSP3
Phvulv091013862m|PACid:23538279 XP_007148990.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]