SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091014153m|PACid:23544252 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091014153m|PACid:23544252
Domain Number 1 Region: 90-132
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 3.92e-18
Family Sigma2 domain of RNA polymerase sigma factors 0.0011
Further Details:      
 
Domain Number 2 Region: 134-192
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000001
Family Sigma3 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091014153m|PACid:23544252
Sequence length 205
Sequence
MLIPNMSLSSLPSFPMHHSLQPTKFATNSDTSTEAVTLVNASVQTEVSVIGNNENGSIVG
FRKSWYLSSREEAELCLDLRVSSDKTQTPQEGTVGLLRGAEKFEPERGYKLSTYVYWWIK
QAMIKAIARKSRLVRLPSGKSEMVAKVAQANNILSSRLRRKPTYDETAEVLNVKASTIRL
VSEKSRKPISLDKVVTDCGHMTLQV
Download sequence
Identical sequences V7BSE9
Phvulv091014153m|PACid:23544252 XP_007148890.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]