SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091028546m|PACid:23557439 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091028546m|PACid:23557439
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.1e-27
Family N-terminal domain of MutM-like DNA repair proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.49e-25
Family Middle domain of MutM-like DNA repair proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091028546m|PACid:23557439
Sequence length 390
Sequence
MPELPEVEAARRAVEENCVGKKITKCIVADDSKVIDAVSRSDFEASVIGKLIVAAHRKGK
NMWLQLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDEDEWPSKYSKFFIELDDGLEL
SFTDKRRFAKVRLLKDPTSVPPISELGPDALFEPMTLEKFTESLHKRKTEIKALLLDQSY
ISGIGNWVADEVLYQARIHPRQAASSLSDASCSTLYKSIEEVIEKAVEVGADSNQYPNSW
IFHSREKKPDKAFVDGNKIDFITAGGRTTAYVPELQKLSGSIDVKETGKPKRQASKKVSG
DDDTEKPTDGEEGDLGNVKSKKGAKAGVKGRKPAIKKKSEESDEDNDSDAQVEKKNPGNV
TNRKQVGEEKVSKKRVQSNQTGRSSKRKAK
Download sequence
Identical sequences Phvulv091028546m|PACid:23557439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]