SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091007677m|PACid:23541523 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091007677m|PACid:23541523
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily TSP9-like 1.27e-23
Family TSP9-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091007677m|PACid:23541523
Sequence length 91
Sequence
MASIIMSFSPATGRVFAATAAKGAGGSKEEKGFLDWILGGLQKEDQLLETDPILKKVEEK
NGGTTTSNGRKNSVAVPQKKKGGFGGLFAKN
Download sequence
Identical sequences V7BQ66
Phvulv091007677m|PACid:23541523 XP_007146732.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]